Answer:
b. Alveolar dead space
Explanation:
Based on the information provided within the question it can be said that the statement that would best indicate that the nurse understands the condition would be "Alveolar dead space". This is because, this is the name of the condition being described by the pulmonologist. It is the sum of the volumes of the alveoli that are ventilated but not perfused due to almost no blood flowing through their pulmonary capillaries.
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
Water (H
2O) is a polar inorganic compound that is at room temperature a tasteless and odorless liquid, which is nearly colorless apart from an inherent hint of blue. It is by far the most studied chemical compound and is described as the "universal solvent" [17][18] and the "solvent of life".[19] It is the most abundant substance on Earth[20] and the only common substance to exist as a solid, liquid, and gas on Earth's surface.[21] It is also the third most abundant molecule in the universe.[20]
Because soap is more basic, adding the acidic solution of lemon juice will decrease the pH value and cause it to become more acidic.
Answer: DNA is a molecule made up of two strands, twisted around each other in a double helix shape. The two strands are complementary which have a 5 prime end and a 3 prime end. To understand this question you must first understand the steps that follow.
DNA Replication:
<u>Step one: </u>
DNA Helicase (unzips) separates the strands.
<u>Step two:</u>
DNA Primase starts the process and makes a small piece of RNA called a primer. This marks the starting point for the DNA.
<u>Step three:</u>
DNA Polymerase binds to the primer and will make the new strand of DNA. DNA Polymerase can only add DNA bases in one direction, from the 5 prime end to the 3 prime end.
- The leading strand is made continuously.
- The lagging strand does not run continuously because it runs in the opposite direction. Each fragment is started with an RNA primer. DNA Polymerase then adds a short row of DNA bases from the 5 prime to 3 prime direction. This results in okazaki fragments because it can only replicate in small chunks. The process is repeated.
<u>Step four:</u>
Once the new DNA is complete the enzyme exonuclease removes all the RNA primers from both strands of DNA.
<u>Step five:</u>
Another DNA Polymerase fills in the gaps that are left behind with DNA.
<u>Step six:</u>
DNA Ligase seals up the fragments in DNA, in both strands to make a continuous double strand.
<u>Final answer:</u>
DNA Replication cannot replicate at the same time due to the leading and lagging strand.
Good luck!