All categories

1 year ago

There are 5 structures that every cell has which of the following is not one of those structures

Biology

1 answer:

Ivahew [28]1 year ago

6 0

Answer:the 3 one

Explanation:

You might be interested in

Choose the sentence that best explains the importance of setting goals and sharing them with others.

ValentinkaMS [17]

A. You improve your health by setting as many goals as you can

8 0

2 years ago

Read 2 more answers

DNA____.

Luden [163]

The answer for this question is C, I just did my final for Biology and got a good score in it.

Hope it helps!

7 0

3 years ago

4a) From the sequence below, identify which portion could be a transmembrane helix. Please underline the portion you select in y

arlik [135]

Answer:

FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT

The bold region of the above sequence will be in the transmembrane region.

4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.

4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.

7 0

2 years ago

1. What are the end products of photosynthesis?

Firlakuza [10]

Answer:

1. Glucose And Oxygen.

2. Transpiration is the process by which water is lost in the form of water vapour by evaporation from the surface of leaves and other serial parts of plant .

3. A. Cooling Effect : The water keeps on evaporating from the leaf surface during transpiration . The heat required for evaporation of water is obtained from the plant itself and thus, the plant cools itself when it is hot outside.

B. Transpiration Pull : As water evaporates from the leaf surface, the roots pull up more water from the soil to make up for the water loss during transpiration .As a result, important mineral salts are also brought along with the water. These salts are necessary for the growth of the plant .

4. Leaf Tendrils : Sweet Pea

Spines : Cactus

Scale Leaves : Onion

5. Pitcher Plant, Venus FlyTrap, Blodderwort

6. Normally plants propogate with the help of seeds contained in the fruits . But some new plants may also be produced from other part of the plant such as the roots, stems, and leaves . This type of reproduction is called vegetative propogation .

E.g. = Bryophyllum .

Explanation:

<h3 /><h3>Hope it works out !!</h3>

7 0

2 years ago

Which of these engulf bacteria and break them down?

Kamila [148]

Answer:

B. phagocytes

Explanation:

Phagocytosis is a process wherein a cell binds to the item it wants to engulf on the cell surface and draws the item inward while engulfing around it. The process of phagocytosis often happens when the cell is trying to destroy something, like a virus or an infected cell, and is often used by immune system cells.

7 0

2 years ago

Read 2 more answers