The recombinant offsprings are normally the offsprings containing a combination of the parents allele, result in a genotype that differs from both parents genotype. The phenotype May be different as well although it is likely that the phenotype could be the same as the parents, as seen in the case of heterozygous dominant having the same phenotype as homozygous dominant.
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
The substance that would not transport readily in blood is : Triglycerides ( B )
<u>Although your question lacks some data below are the missing options</u>
-
Fibrinogen
-
Triglycerides
-
Monosaccharides
-
Albumin
-
Carbohydrates
Triglycerides are not readily transported in blood but it is contained in dietary fat which is been absorbed by the body through the intestine in the form of chylomicrons ( triglyceride-rich lipoproteins ).
When the chylomicrons gets to the liver, the liver disassociates the Triglycerides from the chylomicrons that is needed by the body for energy.
Hence we conclude that the substance that would not transport readily in blood is Triglycerides.
Learn more : brainly.com/question/18343347
All food chains begin with producers
Answer:
there it is fella
i guess the hand writing is not that bad
