C.
Biotic mean alive, so we can cut off the first 2 easily. Aquatic birds eat frogs, so that one is safe for now. A decrease in something parasitic usually helps the population, so D is out too. The only one left is C.
The answer is true because the weight of all of the parts is 2300 when you put them together they will stay 2,300
Answer:
the fourth one. biomagnofication is when an organism ingests other plants or animals that have toxins in them. the toxins are widely distributed
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
Answer:
The average trait value changed in one direction.(In this case, larger size)
Explanation:
In evolution a natural selection can be disruptive, directional or stabilizing
In stabilizing no extreme trait is favored hence provides intermediate values .
Disruptive selection both extreme traits are favored over the intermediate trait.
Directional, the enviroment will favor the survival of one trait hence a change in direction either towards the left or the right.
In the case of swallow cliff mortality, selection favored the larger size.