Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
<span>Most elephant shrew species were first describedin the 1800s by scientists who ... DNA evidence is very conclusive and some say 99% accurate, however it is possible to challenge it based upon faulty collection and/or faulty lab techniques.</span><span>
</span>
The appropriate answer is c. whole-wheat bread. Honey is a rich source of carbohydrate and corn oil margarine is a good source of fats. Farm-raised salmon is a good source of protein. Whole wheat used to make bread is a plant derivative rich in cellulose which is the main component of fiber. Cellulose can only be found in plant cell walls.
Answer:
d) do all jobs for survival
Explanation:
A single cell perform all its activity on its own.
Answer:
Lophotrochozoans (it is a protostome)
Explanation:
Lophotrochozoa is a group (clade) of protostome animals, i.e. animals that undergo a developmental pattern in which the blastopore develops into the mouth. Lophotrochozoa clade includes bryozoans, annelids, molluscs, brachiopods, and platyhelminthes. Most lophotrochozoans have either a lophophore or trochophore larvae during the planktonic stage. A trochophore larva is a marine planktotrophic larva with several bands of cilia that form the locomotory organ (i.e., the prototroch), which is only found within the Lophotrochozoans.
